DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnk6

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_446258.2 Gene:Kcnk6 / 116491 RGDID:621450 Length:313 Species:Rattus norvegicus


Alignment Length:257 Identity:70/257 - (27%)
Similarity:126/257 - (49%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIR------KYNISQEDFKVMET---- 64
            |.:|....||.:||.:...||...|.|....|....:.::|      .:.:.....:|:..    
  Rat     9 SALVAYAGYLALGALLVARLERPHEARLRAELGTLREQLLRHSPCVAAHALDAFVERVLAAGRLG 73

  Fly    65 -VVLKSESHKAGQQ---WKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMF 125
             .||.:.|..|...   |.|..|.::|:|::||:|||::||.|..||.|::.:|::|:|:.:::.
  Rat    74 RAVLANASGPANASDPAWDFASALFFASTLVTTVGYGYTTPLTDAGKAFSIVFALLGVPITMLLL 138

  Fly   126 QSIGERVNRLSSYV---IKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAAAFSKF-EGWSY 186
            .:..:|::.|.::.   ..::|.....:|  |:...|:.::..:.::.....||.|:.. |.||:
  Rat   139 TASAQRLSLLLTHAPLSWLSLRWGWHPQR--AARWHLVALLMVIVAIFFLIPAAVFAYLEEAWSF 201

  Fly   187 FDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNLLVLRFVT 248
            .|:.|:|||:|:|||.||.|..:......|. .|.:....::..||  ||..|.|...|.|:
  Rat   202 LDAFYFCFISLSTIGLGDYVPGEAPGQPYRS-LYKVLVTAYLFLGL--VAMVLVLQTFRRVS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 19/57 (33%)
Ion_trans_2 169..247 CDD:285168 27/78 (35%)
Kcnk6NP_446258.2 Ion_trans_2 <91..146 CDD:400301 20/54 (37%)
Ion_trans_2 180..259 CDD:400301 27/81 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.