DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnk4

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006230696.1 Gene:Kcnk4 / 116489 RGDID:621449 Length:423 Species:Rattus norvegicus


Alignment Length:283 Identity:82/283 - (28%)
Similarity:132/283 - (46%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYN-ISQEDFKVM---------- 62
            ::|:.....||:.||.||.|||...|::..:.|:|..|..::.:. :||::.:..          
  Rat    33 LALLALVLLYLVSGALVFQALEQPHEQQVQKDLEDGRDQFLKDHPCVSQKNLEGFIKLVAEALGG 97

  Fly    63 ----ETVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLV 123
                ||....|.:|.:.  |....||:::.|::||||||:....|..|:||.:.||:|||||..:
  Rat    98 GANPETSWTNSSNHSSA--WNLGSAFFFSGTIITTIGYGNIALHTDAGRLFCIFYALVGIPLFGM 160

  Fly   124 MFQSIGERVNRLSSYVIKAVRSSLR------------------CKRTVASEVDLI--CVVTTLSS 168
            :...:|:|:.           ||||                  ..|.:::.:.|:  |::..|:.
  Rat   161 LLAGVGDRLG-----------SSLRRGIGHIEAVFLKWHVPPGLVRMLSAVLFLLIGCLLFVLTP 214

  Fly   169 LTIAGGAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLA 233
            ..:      ||..|.||..:::|:..:||||:||||.|  ..|......|.|......:||||||
  Rat   215 TFV------FSYMESWSKLEAIYFVIVTLTTVGFGDYV--PGDGTGQNSPAYQPLVWFWILFGLA 271

  Fly   234 IVAASLNLL--VLRFVTMNTEDE 254
            ..|:.|..:  .||.|:..|..|
  Rat   272 YFASVLTTIGNWLRAVSRRTRAE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 22/54 (41%)
Ion_trans_2 169..247 CDD:285168 28/79 (35%)
Kcnk4XP_006230696.1 Ion_trans_2 <115..169 CDD:285168 22/53 (42%)
Ion_trans_2 207..285 CDD:285168 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.