DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnk17

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_005158968.1 Gene:kcnk17 / 101882139 ZFINID:ZDB-GENE-120113-3 Length:299 Species:Danio rerio


Alignment Length:277 Identity:87/277 - (31%)
Similarity:128/277 - (46%) Gaps:59/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YLLVGAAVFDALESETEKRRWEALQDAEDM------IIRKYN-ISQEDFKVMETVVLKSES---- 71
            |:|||..||..||.      |..||....:      ::.||. :.|.....:..:: ||.|    
Zfish    31 YVLVGGLVFWKLEG------WYVLQQIALLKEKRLELLEKYPCLGQNGLSELAQMI-KSASLSGL 88

  Fly    72 -----HKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGER 131
                 ..|...||||.:..:|.||:||||||:..|.|..|::|.:.:|:.||||.:|:       
Zfish    89 SPDSNDTADGLWKFTSSSVFAATVVTTIGYGNIVPLTTAGQIFCVMFALFGIPLNVVV------- 146

  Fly   132 VNRLSSYVI-----------------KAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAAAFS 179
            :||:..|::                 |.||.|:.....|:|.. |..||..|          .|.
Zfish   147 LNRVGKYMLAIERHFCNFLEKKIDRGKCVRISIHSISFVSSAF-LYLVVPML----------LFK 200

  Fly   180 KFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNLLVL 244
            ::|||||.:::|||||||:||||||.|| ..:..:|....|.....::|.||||.:|..:|..:.
Zfish   201 EYEGWSYAEAIYYCFITLSTIGFGDYVA-DHNPEINYPEWYSCLMAVWIFFGLAWLALLVNHTID 264

  Fly   245 RFVTMNTEDERRDEAQA 261
            ...::|.....|...|:
Zfish   265 LLESLNAYLRGRQTGQS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 23/54 (43%)
Ion_trans_2 169..247 CDD:285168 30/77 (39%)
kcnk17XP_005158968.1 Ion_trans_2 <100..154 CDD:285168 25/60 (42%)
Ion_trans_2 189..267 CDD:285168 34/89 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.