DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and LOC101731658

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_031758165.1 Gene:LOC101731658 / 101731658 -ID:- Length:331 Species:Xenopus tropicalis


Alignment Length:335 Identity:102/335 - (30%)
Similarity:149/335 - (44%) Gaps:95/335 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVCTFTYLLVGAAVFDALESETE--------KRRWEALQDAEDMIIRKYNISQEDFKVME---- 63
            |::....|||||||||.||||:||        :.:||.|:          |.:..|.:.:|    
 Frog    21 LLLIYICYLLVGAAVFWALESQTEVEQSVSFQQDKWELLR----------NFTCMDNRTLELFIK 75

  Fly    64 TVVLKSESHKAG----------QQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118
            ||:   .::|:|          ..|.|.|:|:::.||:||||||:..|||.|.:.|.:.||:.||
 Frog    76 TVI---GAYKSGISPEGNSSNLGSWSFGGSFFFSVTVVTTIGYGNLCPSTAGARAFCVVYALFGI 137

  Fly   119 PLGLVMFQSIGER----VNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAAAFS 179
            ||.|::...||::    |:|....|.|.:|.....|...:....||.::     |.:......|.
 Frog   138 PLNLILLNRIGQKMLSLVHRCGDVVGKRIRRQRLTKLVTSGSALLIGLL-----LFMLLPPVLFR 197

  Fly   180 KFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPE------YVMFALIFILFGLAIVAAS 238
            ..|||:|.:.:||.||||.||||||.|       :.|.|:      |.....::||||||.:|..
 Frog   198 AVEGWTYGEGLYYSFITLATIGFGDYV-------VGRNPDKQYPNWYRNLLSVWILFGLAWLALG 255

  Fly   239 LN-----LLVLR---------------------------FVTMNTEDERRDEAQAMQALQVAVKL 271
            :|     |...|                           ..|..:||...:|.:||.      :.
 Frog   256 INAGADALEHCRERCPCRRKSKNQAAGEELMDPGGEGSLCCTKQSEDSASNETRAMD------QR 314

  Fly   272 EGDVITSNGS 281
            :.|...|:||
 Frog   315 DADTSESSGS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 26/58 (45%)
Ion_trans_2 169..247 CDD:285168 32/115 (28%)
LOC101731658XP_031758165.1 Ion_trans_2 92..151 CDD:400301 26/58 (45%)
Ion_trans_2 194..264 CDD:400301 29/76 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.