DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCNK7

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_203133.1 Gene:KCNK7 / 10089 HGNCID:6282 Length:307 Species:Homo sapiens


Alignment Length:305 Identity:81/305 - (26%)
Similarity:131/305 - (42%) Gaps:45/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVCTFTYLLVGAAVFDALES------ETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVLKS 69
            |:|.....|.:||.||.|||.      :.|.|...|...||..........:|    :....|.:
Human    13 LVVAHLLALGLGAVVFQALEGPPACRLQAELRAELAAFQAEHRACLPPGALEE----LLGTALAT 73

  Fly    70 ESH--------KAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQ 126
            ::|        ..|:.|....|..:|.::|||.||||..|.:.|||.|.|.||.:|:|..|.:..
Human    74 QAHGVSTLGNSSEGRTWDLPSALLFAASILTTTGYGHMAPLSPGGKAFCMVYAALGLPASLALVA 138

  Fly   127 SIGE----RVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAAAFSKFEG-WSY 186
            ::..    .::|..::|  ||...|...|  |:.:..:.:...::|..:...|......:| .|.
Human   139 TLRHCLLPVLSRPRAWV--AVHWQLSPAR--AALLQAVALGLLVASSFVLLPALVLWGLQGDCSL 199

  Fly   187 FDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNLLVLRFVTMNT 251
            ..:||:||.:|:|||..|::. .|..:|:        .:|:.|..||:    |..|:|..:.|..
Human   200 LGAVYFCFSSLSTIGLEDLLP-GRGRSLH--------PVIYHLGQLAL----LGYLLLGLLAMLL 251

  Fly   252 EDERRDEAQAMQALQVAVKLEGDVITSN-GSILSGYEGHDGQSLN 295
            ..|...|...::|:....:..|.|...: |.||    |.|..:|:
Human   252 AVETFSELPQVRAMGKFFRPSGPVTAEDQGGIL----GQDELALS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 21/58 (36%)
Ion_trans_2 169..247 CDD:285168 21/78 (27%)
KCNK7NP_203133.1 Ion_trans_2 <90..140 CDD:285168 21/49 (43%)
Ion_trans_2 182..>220 CDD:285168 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155121
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.