DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnc1

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_031756512.1 Gene:kcnc1 / 100497402 XenbaseID:XB-GENE-996920 Length:644 Species:Xenopus tropicalis


Alignment Length:55 Identity:17/55 - (30%)
Similarity:25/55 - (45%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 FYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRLSSY 138
            |::|...:||:|||...|.|..|.|.....|:.|:   |.:...:...||....|
 Frog   460 FWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGV---LTIAMPVPVIVNNFGMY 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 14/47 (30%)
Ion_trans_2 165..243 CDD:462301
kcnc1XP_031756512.1 Ion_trans 259..516 CDD:459842 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.