DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnk2

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_031758740.1 Gene:kcnk2 / 100495685 XenbaseID:XB-GENE-952207 Length:412 Species:Xenopus tropicalis


Alignment Length:364 Identity:102/364 - (28%)
Similarity:163/364 - (44%) Gaps:63/364 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKY---NISQEDFKVM 62
            ||.:.|.|:.|:|  ..||::||.||.|||...|..:...:...::..|..:   |:::.|..:.
 Frog    43 MKWKTVSTVFLVV--VLYLIIGATVFKALEQPHESAQRTTIVIQKNNFILNHSCVNVTELDELIQ 105

  Fly    63 E--------TVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIP 119
            :        .:.:.:.||: ...|....:|::|.||:||||:|:.:|.|.|||:|.:.||::|||
 Frog   106 QLMAAINAGIIPIGNTSHQ-NSHWDLGSSFFFAGTVITTIGFGNISPRTKGGKIFCIIYALLGIP 169

  Fly   120 LGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTL---SSLTIAGGAAAFSKF 181
            |...:...:|:::..:....|..|...........:::.:|..|..:   ..|.:|..|..|...
 Frog   170 LFGFLLAGVGDQLGTIFGKGIARVEDMFEKWNVSQTKIRIISTVIFILFGCILFVAIPAVIFQHI 234

  Fly   182 EGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMF----ALIFILFGLAIVAASLNLL 242
            |.|...|:.|:..||||||||||.||...|      .||:.|    ...:||.|||..||.|:::
 Frog   235 EDWHTLDAFYFVVITLTTIGFGDYVAGGSD------IEYLDFYKPVVWFWILVGLAYFAAVLSMI 293

  Fly   243 V--LRFVTMNTEDE-----------------------RR------DEAQAMQALQVAVKLEGDV- 275
            .  ||.::..|::|                       ||      |:.|  :|..:..||..:: 
 Frog   294 SDWLRVISRKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQ--RATSIKRKLSAELA 356

  Fly   276 ITSNGSILSGYEGHDGQSLNGSNT--SSMCSCHCICLNG 312
            :|||..:...........|:....  |.|..|..|.|||
 Frog   357 MTSNPEMTPCKRTLSVNHLSNDKELFSPMTKCESIYLNG 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 23/54 (43%)
Ion_trans_2 169..247 CDD:285168 34/83 (41%)
kcnk2XP_031758740.1 Ion_trans_2 <128..182 CDD:400301 23/53 (43%)
Ion_trans_2 220..298 CDD:400301 32/83 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2827
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.