DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnc2

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_002939991.2 Gene:kcnc2 / 100489216 XenbaseID:XB-GENE-1013657 Length:598 Species:Xenopus tropicalis


Alignment Length:69 Identity:21/69 - (30%)
Similarity:31/69 - (44%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 FYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRLSSYVIKAV-RSSL 147
            |::|...:||:|||...|.|..|.|.....|:.|:   |.:...:...||....|...|: :..|
 Frog   391 FWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGV---LTIAMPVPVIVNNFGMYYSLAMAKQKL 452

  Fly   148 RCKR 151
            ..||
 Frog   453 PRKR 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 14/47 (30%)
Ion_trans_2 165..243 CDD:462301
kcnc2XP_002939991.2 BTB_KCNC2_4 7..129 CDD:349722
Ion_trans 191..447 CDD:459842 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.