DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnc1b

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001182126.2 Gene:kcnc1b / 100334453 ZFINID:ZDB-GENE-080414-3 Length:598 Species:Danio rerio


Alignment Length:88 Identity:23/88 - (26%)
Similarity:37/88 - (42%) Gaps:16/88 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 FYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI-----PLGLV-----MFQSIGERVNRLSSY 138
            |::|...:||:|||...|.|..|.|.....|:.|:     |:.::     |:.|:.....:|...
Zfish   390 FWWAVVTMTTLGYGDMYPQTTSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKK 454

  Fly   139 VIKAVR------SSLRCKRTVAS 155
            ..|.:|      |...|:..|.|
Zfish   455 KNKHIRRPPLLGSPNYCRSAVNS 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 16/57 (28%)
Ion_trans_2 165..243 CDD:462301
kcnc1bNP_001182126.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.