DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and si:dkey-43k4.5

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_021332757.1 Gene:si:dkey-43k4.5 / 100148290 ZFINID:ZDB-GENE-120215-82 Length:487 Species:Danio rerio


Alignment Length:153 Identity:31/153 - (20%)
Similarity:58/153 - (37%) Gaps:54/153 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVL 67
            :.:.|.:.:::   .||.||.:||..:                     .|....|:...::|:  
Zfish   322 RHSYREVGILL---LYLAVGVSVFSGM---------------------AYTAENEEDVGLDTI-- 360

  Fly    68 KSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTM-CY----AIVGIPLGLVMFQS 127
                         ...:::.|..:||:|||...|.||.|||... |.    .:|.:|:.::.   
Zfish   361 -------------PACWWWGTVSMTTVGYGDVVPVTVAGKLAASGCILGGTLVVALPITIIF--- 409

  Fly   128 IGERVNRLSSYV--IKAVRSSLR 148
                 |:.|.:.  .||:.:|:|
Zfish   410 -----NKFSHFYRKQKALEASVR 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 15/58 (26%)
Ion_trans_2 165..243 CDD:462301
si:dkey-43k4.5XP_021332757.1 BTB_POZ 18..122 CDD:453885
Ion_trans 185..420 CDD:459842 27/144 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.