DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnk7

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001116288.1 Gene:kcnk7 / 100144289 XenbaseID:XB-GENE-5731928 Length:322 Species:Xenopus tropicalis


Alignment Length:304 Identity:85/304 - (27%)
Similarity:139/304 - (45%) Gaps:51/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RTISLIVCTFTY---LLVGAAVFDALESETEKRRWEALQDAEDMIIRKY----NISQEDFKVMET 64
            |.:.|::...:|   ||:||.||..||...|:|....::......:.|:    .:..:|| :.:.
 Frog     5 RALFLLLLLLSYSLFLLLGAFVFSTLEQPQEERLRREVETMWSEFLAKHPCLSEVLLDDF-IRKA 68

  Fly    65 VVLKS---------ESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPL 120
            :::||         ..|:.  :|.|..:.::..|.||||||||..|.::|||.|.:.|||.||||
 Frog    69 LLVKSFGVSVHRNISIHEL--KWDFISSLFFTGTTLTTIGYGHPFPISLGGKAFCLVYAIFGIPL 131

  Fly   121 GLVMFQSI---------GERVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAA 176
            .|.:...|         .:.:|:|..      :.|:..|:.......:....|.|....|.  |.
 Frog   132 TLSVLSIIVRNLLILLWDKPINKLQR------QCSISRKKLEWILASIFIFFTALIFFFIP--AI 188

  Fly   177 AFSKF-EGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPE-YVMFALIFILFGLAIVAASL 239
            .|:.. |.|.|.|::|:|||:|:|||.||.|..:|:.  .|.|. |.:..:.::|.||..|...:
 Frog   189 VFNAIEENWGYVDALYFCFISLSTIGLGDYVPGERNE--QRLPVLYKLLVICYLLIGLVAVFLVV 251

  Fly   240 NLL--VLRF-----VTMNTEDERRDEAQAMQALQVAVKLEGDVI 276
            .::  ||.:     :.:..||.|..|.    ...:|.|..|.::
 Frog   252 EVIKNVLNYNRLFGLFLFGEDRRDWET----GCDLACKAGGPIV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 25/63 (40%)
Ion_trans_2 169..247 CDD:285168 28/86 (33%)
kcnk7NP_001116288.1 Ion_trans_2 <88..141 CDD:285168 25/52 (48%)
Ion_trans_2 178..254 CDD:285168 28/79 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.