DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnf1

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001096396.1 Gene:kcnf1 / 100124998 XenbaseID:XB-GENE-979363 Length:484 Species:Xenopus tropicalis


Alignment Length:229 Identity:50/229 - (21%)
Similarity:94/229 - (41%) Gaps:69/229 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRLSSY------VIKAV 143
            :|.:.:||.:|      :|:.| |..:..||..:.:..:      .|:.:|:.:      :..|:
 Frog   264 FYVSIILTNLG------ATIMG-LTNVQQAIQALRIMRI------ARIFKLARHSSGLQTLTYAL 315

  Fly   144 RSSLRCKRTVASEVDLICVVTTLSSLTIAGGAAAFSKFEGW--------SYFDSV----YYCFIT 196
            :||.:       |:.|:.       :.:|.|...||.. |:        :.|.|:    ::..||
 Frog   316 KSSFK-------ELGLLL-------MYLAVGIFVFSAL-GYTMEQSHPDTLFKSIPQSFWWAIIT 365

  Fly   197 LTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNLLVLRFVTMNTEDERRDEAQA 261
            :||:|:||:........||        |....|.|:..:|..::.::..||....:         
 Frog   366 MTTVGYGDIYPKTTLGKLN--------AATSFLCGVIAIALPIHPIINNFVKYYNK--------- 413

  Fly   262 MQALQVAVKLEGDV--ITSNGSILSGYEGHDGQS 293
            .:.|:.|.|.|.::  :.|||    ||.|.:|.|
 Frog   414 QRVLETATKHELELMELHSNG----GYLGTNGSS 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 9/46 (20%)
Ion_trans_2 165..243 CDD:462301 20/89 (22%)
kcnf1NP_001096396.1 BTB_POZ_Kv5_KCNF1 21..136 CDD:349690
Ion_trans 179..415 CDD:459842 38/195 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.