DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnc2

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001429226.1 Gene:kcnc2 / 100037377 ZFINID:ZDB-GENE-070410-118 Length:593 Species:Danio rerio


Alignment Length:88 Identity:21/88 - (23%)
Similarity:42/88 - (47%) Gaps:16/88 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 FYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI-----PLGLV-----MFQSIGERVNRL--- 135
            |::|...:||:|||...|.|..|.:.....|:.|:     |:.::     |:.|:.....:|   
Zfish   386 FWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKK 450

  Fly   136 -SSYVIKAVR--SSLRCKRTVAS 155
             ..::.:||:  |.|.|:..:::
Zfish   451 RKKHIPQAVQTGSPLYCRTDLST 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 15/57 (26%)
Ion_trans_2 165..243 CDD:462301
kcnc2NP_001429226.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.