DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and si:ch211-261a10.5

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_021321992.1 Gene:si:ch211-261a10.5 / 100003275 ZFINID:ZDB-GENE-131127-398 Length:306 Species:Danio rerio


Alignment Length:279 Identity:60/279 - (21%)
Similarity:109/279 - (39%) Gaps:83/279 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 STPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRLSSYVIKAVRS----SLRCKRTVASEVD- 158
            :.|:|..||:|.:.|.::|....::.|....||:..|.:::....|.    :.:.||.:...|: 
Zfish     2 AAPATHNGKIFLIFYGLIGCATTMLFFNLFLERMITLITFLTNRCRKQQQRTKQSKRHIVPNVNT 66

  Fly   159 --------------------LICVVTTLSSLTIAGGAAAFSKFEGWSYFDSVYYCFITLTTIGFG 203
                                ::.||..|.:|   |.:..:|..|.|||.:|:|:||:..||:|||
Zfish    67 HPENGDIHESWKPSVYYVTLILAVVALLVNL---GASGLYSAMEDWSYLESMYFCFVAFTTMGFG 128

  Fly   204 DMVALQRDNALNRKPEYVMFALIFIL-----FGLAIVAA-----SLNLLVLRFVTMN-------- 250
            |||:.|:.....|....|..:|:.||     :.|..|.|     .||.::.:..:|:        
Zfish   129 DMVSGQKAYYEVRWVYQVANSLMIILGVSCTYSLVSVTAIIIKQMLNWILAKLFSMHCCFSITTP 193

  Fly   251 ----TEDERRDEAQAMQALQVAVKLEGDVITSNGSILSGYEGHDGQSLNGSNTSSMCSCHC---- 307
                ..:::...|.:.|:....||                          ::.||...|.|    
Zfish   194 KVKEAANQQIQNASSHQSTCHVVK--------------------------ASCSSKSKCKCASSA 232

  Fly   308 ---ICLNGNRHKKSSNLEK 323
               :|.:|:....:.:.|:
Zfish   233 VETVCQSGDTANSAPSFER 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 9/32 (28%)
Ion_trans_2 169..247 CDD:285168 30/87 (34%)
si:ch211-261a10.5XP_021321992.1 Ion_trans_2 90..172 CDD:311712 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590180
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.