DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and SRSF9

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_003760.1 Gene:SRSF9 / 8683 HGNCID:10791 Length:221 Species:Homo sapiens


Alignment Length:251 Identity:96/251 - (38%)
Similarity:124/251 - (49%) Gaps:65/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYG-----FVEFEDYRDADDAVYELNGKELLG 64
            |:|||.||..|||:|||..|..|||.|:|.:||.:|     ||.|||.|||:||:|..||.:...
Human    15 RIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQ 79

  Fly    65 ERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPL-RTEYRLIVENLS 128
            .|:.||             :...||||.|...|            .|.|||. |:::|::|..|.
Human    80 CRLRVE-------------FPRTYGGRGGWPRG------------GRNGPPTRRSDFRVLVSGLP 119

  Fly   129 SRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGR-------RI 186
            ...|||||||:||:||:|.|||.  |:...|:||:....||:.|:.|||||:....       |:
Human   120 PSGSWQDLKDHMREAGDVCYADV--QKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRV 182

  Fly   187 HLVEDRRGGRSGGGGGSGRGRSRSSS---SRSRSRSRRRS---RSRRSSHSRSKSR 236
            :                   ..||:|   |||||.||.|.   :||.|.|..|..|
Human   183 Y-------------------PERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 37/73 (51%)
RRM2_SRSF4_like 120..191 CDD:241044 31/77 (40%)
SRSF9NP_003760.1 RRM1_SRSF9 15..86 CDD:241042 37/83 (45%)
RRM2_SRSF9 104..186 CDD:410161 34/102 (33%)
Interaction with SAFB1 188..200 6/11 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..221 15/31 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.