DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and SNP1

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_012203.1 Gene:SNP1 / 854749 SGDID:S000001323 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:131 Identity:33/131 - (25%)
Similarity:56/131 - (42%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILI--------KNGYGFVEFEDYRDADDAVYEL---NG 59
            :::|.|||.:.|.:|:::|..:|....|.|        ..||.|:.|:|...:..|..|:   .|
Yeast   109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHRG 173

  Fly    60 KELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGG---------GRYNEKNKNSRSSSRYGPP 115
            .::.....:|:..||......:.|   |.||..||.|         ||:...:.::.:...|.|.
Yeast   174 IQIKDRICIVDIERGRTVKYFKPR---RLGGGLGGRGYSNRDSRLPGRFASASTSNPAERNYAPR 235

  Fly   116 L 116
            |
Yeast   236 L 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 19/78 (24%)
RRM2_SRSF4_like 120..191 CDD:241044
SNP1NP_012203.1 U1snRNP70_N 6..95 CDD:403437
RRM_SNP1_like 89..201 CDD:410194 23/94 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.