DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and RIE1

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_011766.3 Gene:RIE1 / 853165 SGDID:S000003482 Length:781 Species:Saccharomyces cerevisiae


Alignment Length:197 Identity:43/197 - (21%)
Similarity:66/197 - (33%) Gaps:75/197 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILI------KN---------------------GYGF 41
            |.:||..:|....:.||..|:|.:|....:.:      ||                     ||||
Yeast   540 SNLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGSSRGYGF 604

  Fly    42 VEFEDYRDADDAVYELNGKELLGERVV---VEPARGTARGSNRD------------------RYD 85
            |.||...||..|:...:|.::..::|:   ....||....|:.|                  .|.
Yeast   605 VSFESPLDAAKAILNTDGYQVSKDQVLSVSFAQKRGNLSSSDDDDQSQTDNSSKFQNFQPHNDYH 669

  Fly    86 DRYGGRRGGGGGRYNEK--------NKNSRSSSR--YGPPLR---------TEYRLIVENLSSRV 131
            ..|       ..:||:|        |::.:..||  |..||:         ..|.||..| .:..
Yeast   670 KAY-------PTKYNKKFINALMTQNQSQQQVSRENYFIPLQYPNTNTKPVNSYNLISAN-QNNA 726

  Fly   132 SW 133
            :|
Yeast   727 NW 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 22/98 (22%)
RRM2_SRSF4_like 120..191 CDD:241044 5/14 (36%)
RIE1NP_011766.3 PABP-1234 195..757 CDD:130689 43/197 (22%)
RRM3_CELF1-6 542..634 CDD:409797 22/91 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.