DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and PTI1

DIOPT Version :10

Sequence 1:NP_788671.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_011672.1 Gene:PTI1 / 853060 SGDID:S000003388 Length:425 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:24/81 - (29%)
Similarity:34/81 - (41%) Gaps:14/81 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PPLRT-EYRLIVENLSSRV-------SW-QD-LKDYMRQAGEVTYADAHKQRRN---EGVV-EFA 164
            |..|| .:.|..|||||.:       .| || :...:..:|.|....|....|.   .||: ::.
Yeast     4 PRRRTGRHFLTPENLSSTLQITNLPPEWNQDIITSVVAGSGPVIDIKAKNDPRTGKLTGVLFDYL 68

  Fly   165 SLSDMKTAIEKLDDTE 180
            :..|.|.|.|.|:..|
Yeast    69 TSKDCKRAWEILNRIE 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_788671.2 RRM1_SRSF4_like 5..74 CDD:409774
RRM2_SRSF4_like 120..191 CDD:410012 21/74 (28%)
PTI1NP_011672.1 RRM 21..90 CDD:214636 15/64 (23%)
CSTF2_hinge 185..255 CDD:433869
PABP-1234 <306..413 CDD:130689
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.