DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and RNA15

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_011471.1 Gene:RNA15 / 852838 SGDID:S000003012 Length:296 Species:Saccharomyces cerevisiae


Alignment Length:123 Identity:32/123 - (26%)
Similarity:47/123 - (38%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILI--------KNGYGFVEFEDYRDADDAVYELNGKEL 62
            ||:|.:||...|..:.......|...::.:        ..||.|:||.|...:..||..|||.: 
Yeast    20 VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQ- 83

  Fly    63 LGERVVVEPARGTARGSNRD------RYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGP 114
            ||.|.:     .....||.|      :...:|....|.     |..|.|:.::|. ||
Yeast    84 LGSRFL-----KCGYSSNSDISGVSQQQQQQYNNINGN-----NNNNGNNNNNSN-GP 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 21/75 (28%)
RRM2_SRSF4_like 120..191 CDD:241044
RNA15NP_011471.1 RRM_CSTF2_RNA15_like 18..94 CDD:409832 21/79 (27%)
CSTF_C 255..291 CDD:405061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.