DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and SR34

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_850933.1 Gene:SR34 / 839262 AraportID:AT1G02840 Length:303 Species:Arabidopsis thaliana


Alignment Length:339 Identity:142/339 - (41%)
Similarity:190/339 - (56%) Gaps:53/339 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILIK-----NGYGFVEFEDYRDADDAVYELNGKELLGE 65
            ||||.||..:|||::|..|..||....|.:|     .||.||||:|.|||:||::..:|.:..|.
plant     9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGYDFDGH 73

  Fly    66 RVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSR 130
            |:.||.|.|..|.|: |......||.||||.||       ....|| ||..|:|:|::|..|.|.
plant    74 RLRVEL
AHGGRRSSD-DTRGSFNGGGRGGGRGR-------GDGGSR-GPSRRSEFRVLVTGLPSS 129

  Fly   131 VSWQDLKDYMRQAGEVTYADAHKQRR-NEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRG 194
            .|||||||:||:.|:|.::..::..| ..|||::....|||.|::||||||.             
plant   130 ASWQDLKDHMRKGGDVCFSQVYRDARGTTGVVDYTCYEDMKYALKKLDDTEF------------- 181

  Fly   195 GRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSR 259
             |:....|..|.|...|...|||.||.|      |:|:|:||||     |||.|:|  :||||||
plant   182 -RNAFSNGYVRVREYDSRKDSRSPSRGR------SYSKSRSRSR-----GRSVSRS--RSRSRSR 232

  Fly   260 SRSNKSRDVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSKRESRSRSRS--KSIHRD-SRSRDRS 321
            |||.|    :||..:|.:::.||||    ..||:|||.|.|.|||||||  .|:.:: |:|..:.
plant   233 SRSPK----AKSSRRSPAKSTSRSP----GPRSKSRSPSPRRSRSRSRSPLPSVQKEGSKSPSKP 289

  Fly   322 ASAENKSRSRSRSR 335
            :.|::...:||.||
plant   290 SPAKSPIHTRSPSR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 33/72 (46%)
RRM2_SRSF4_like 120..191 CDD:241044 29/71 (41%)
SR34NP_850933.1 RRM1_SF2_plant_like 8..79 CDD:241043 31/69 (45%)
RRM2_SF2_plant_like 119..194 CDD:241046 32/88 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.