DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and RBM4B

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_113680.1 Gene:RBM4B / 83759 HGNCID:28842 Length:359 Species:Homo sapiens


Alignment Length:209 Identity:52/209 - (24%)
Similarity:83/209 - (39%) Gaps:57/209 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVV 69
            ::::|.||....|:::...|:.||:..:..|...||||..||...|:||:..|:..:|.|..:.|
Human     3 KLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINV 67

  Fly    70 EPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQ 134
            |.:                             |||:..|:           :|.|.|:|...:.|
Human    68 EAS-----------------------------KNKSKAST-----------KLHVGNISPTCTNQ 92

  Fly   135 DLKDYMRQAGEV-------TYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDR 192
            :|:....:.|.|       .||..|.:|..:.|          .||..||:||..|:|:|:....
Human    93 ELRAKFEEYGPVIECDIVKDYAFVHMERAEDAV----------EAIRGLDNTEFQGKRMHVQLST 147

  Fly   193 RGGRSGGGGGSGRG 206
            ...|:..|.|...|
Human   148 SRLRTAPGMGDQSG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 22/68 (32%)
RRM2_SRSF4_like 120..191 CDD:241044 22/77 (29%)
RBM4BNP_113680.1 RRM1_RBM4 2..68 CDD:410018 20/64 (31%)
RRM2_RBM4 78..144 CDD:410019 22/86 (26%)
PTZ00368 <145..>181 CDD:173561 4/17 (24%)
ZnF_C2HC 161..176 CDD:197667 1/1 (100%)
Interaction with TNPO3. /evidence=ECO:0000250 196..359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.