DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and SR30

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_172386.3 Gene:SR30 / 837433 AraportID:AT1G09140 Length:268 Species:Arabidopsis thaliana


Alignment Length:290 Identity:120/290 - (41%)
Similarity:156/290 - (53%) Gaps:52/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILIK-----NGYGFVEFEDYRDADDAVYELNGKELLGE 65
            :|||.||..:|:.::|..|..||...||.:|     .||.||||||.||||||:|..:|.:..|.
plant     9 IYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRPPGYAFVEFEDPRDADDAIYGRDGYDFDGC 73

  Fly    66 RVVVEPARGTARGS-NRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSS 129
            |:.||.|.|..|.| :.|||...|                   |:|| .|..|::||::|..|..
plant    74 RLRVEIAHGGRRFSPSVDRYSSSY-------------------SASR-APSRRSDYRVLVTGLPP 118

  Fly   130 RVSWQDLKDYMRQAGEVTYADAHKQRRN-EGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRR 193
            ..|||||||:||:||:|.:::....|:. .|||::::..|||.||.|||.||..           
plant   119 SASWQDLKDHMRKAGDVCFSEVFPDRKGMSGVVDYSNYDDMKYAIRKLDATEFR----------- 172

  Fly   194 GGRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKS---R 255
                 ....|...|.|...|||.|||...|:|.|   |||:||..|.|...:|:|.||.:|   |
plant   173 -----NAFSSAYIRVREYESRSVSRSPDDSKSYR---SRSRSRGPSCSYSSKSRSVSPARSISPR 229

  Fly   256 SR--SRSRSNKSRDVSKSKSKSHSRTRSRS 283
            ||  |||||..| .||:|:|:|.||:||||
plant   230 SRPLSRSRSLYS-SVSRSQSRSKSRSRSRS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 34/72 (47%)
RRM2_SRSF4_like 120..191 CDD:241044 30/71 (42%)
SR30NP_172386.3 RRM <1..165 CDD:223796 71/175 (41%)
RRM1_SF2_plant_like 8..79 CDD:241043 32/69 (46%)
RRM2_SF2_plant_like 109..184 CDD:241046 32/90 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.