DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and RS40

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001190837.1 Gene:RS40 / 828654 AraportID:AT4G25500 Length:350 Species:Arabidopsis thaliana


Alignment Length:358 Identity:103/358 - (28%)
Similarity:154/358 - (43%) Gaps:60/358 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKEL--LGERVV 68
            |:.|...|..||.||||.|:.||:...:.:|.|:.||..||.|||:||:..|:..|.  .|.|:.
plant     4 VFCGNFEYDAREGDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALDRFEFGRKGRRLR 68

  Fly    69 VEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENL-SSRVS 132
            ||..:           .:|.|.:|.|||.|        ||||    .:|....|.|.|. :....
plant    69 VEWTK
-----------SERGGDKRSGGGSR--------RSSS----SMRPSKTLFVINFDADNTR 110

  Fly   133 WQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRI---HLVEDRRG 194
            .:||:.:....|::...   :.|||...:::.:..|...|::..::::|..:.|   :.|:|  .
plant   111 TRDLEKHFEPYGKIVNV---RIRRNFAFIQYEAQEDATRALDASNNSKLMDKVISVEYAVKD--D 170

  Fly   195 GRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKS------RSRSKSRGGRSKSKSPVK 253
            ...|.|....|.|.||...|.||.|..:.......:.|..|      :.|:....||.:|.||.|
plant   171 DARGNGHSPERRRDRSPERRRRSPSPYKRERGSPDYGRGASPVAAYRKERTSPDYGRRRSPSPYK 235

  Fly   254 SRSRSR---SRSNKSRDVSKSKSKSHSRTR-SRSPKRERDSRSRSRSVSKRESRSRSRSKSIHRD 314
            ...|..   .|..:..|..:.:.:..|.|: ||||..:|:..|.:.|..|:||            
plant   236 KSRRGSPEYGRDRRGNDSPRRRERVASPTKYSRSPNNKRERMSPNHSPFKKES------------ 288

  Fly   315 SRSRDRSASAENKSRSRSRSRSASPKNGNA-SP 346
              .|:.....|:....|.|||| ||:||.. ||
plant   289 --PRNGVGEVESPIERRERSRS-SPENGQVESP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 29/69 (42%)
RRM2_SRSF4_like 120..191 CDD:241044 14/74 (19%)
RS40NP_001190837.1 RRM1_AtRSp31_like 2..73 CDD:240680 29/68 (43%)
RRM_SF 98..167 CDD:388407 13/71 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.