DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and RS2Z32

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_190918.3 Gene:RS2Z32 / 824518 AraportID:AT3G53500 Length:284 Species:Arabidopsis thaliana


Alignment Length:357 Identity:116/357 - (32%)
Similarity:143/357 - (40%) Gaps:97/357 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVV 68
            :|:|||.|....|.|||||.|..|||.||:.:|..|.||||.|.||||||.|.|:|::..|.|:.
plant    11 TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADDARYYLDGRDFDGSRIT 75

  Fly    69 VEPARGTARGSNRDRYDDRYGGRRG---GGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSR 130
            ||.:||..|||       |..|.||   |.|..:|                              
plant    76 VEASRGAPRGS-------RDNGSRGPPPGSGRCFN------------------------------ 103

  Fly   131 VSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRGG 195
                        .|    .|.|..|.       .:..|.|....:.      |.|.|:..:.:..
plant   104 ------------CG----VDGHWARD-------CTAGDWKNKCYRC------GERGHIERNCKNS 139

  Fly   196 RSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRS-- 258
            .|......|...|| |..:|||..||||.||..|:||.:|.|||:|...|.||   |:.||||  
plant   140 PSPKKARQGGSYSR-SPVKSRSPRRRRSPSRSRSYSRGRSYSRSRSPVRREKS---VEDRSRSPK 200

  Fly   259 ---RSRSNKSRDVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSKRESRSRSRSKSIHRDSRS--- 317
               ||.|.|.||.|.|..:   :....||||..|....    .|.....|:.:..|.....|   
plant   201 AMERSVSPKGRDQSLSPDR---KVIDASPKRGSDYDGS----PKENGNGRNSASPIVGGGESPVG 258

  Fly   318 ---RDRSASAENKSRSRSRSRSASPKNGNASP 346
               :|||...:....||     .||| |:.||
plant   259 LNGQDRSPIDDEAELSR-----PSPK-GSESP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 37/68 (54%)
RRM2_SRSF4_like 120..191 CDD:241044 9/70 (13%)
RS2Z32NP_190918.3 RRM_SF 12..81 CDD:388407 37/68 (54%)
PTZ00368 <86..142 CDD:173561 17/121 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 70 1.000 Domainoid score I3406
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.