DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and SR34a

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001190041.1 Gene:SR34a / 824105 AraportID:AT3G49430 Length:300 Species:Arabidopsis thaliana


Alignment Length:322 Identity:145/322 - (45%)
Similarity:174/322 - (54%) Gaps:50/322 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILIK-----NGYGFVEFEDYRDADDAVYELNGKELLGE 65
            :|||.||..:||.::|..|..|||..||.:|     ..|.|||||..|||:||:...:|..|.|.
plant     9 IYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPPRPPCYCFVEFEHSRDAEDAIKGRDGYNLDGC 73

  Fly    66 RVVVEPARGTARGSNRDRY------DDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIV 124
            |:.||.|.|....|:.||.      ...|||  |||||          .|:|:|....:|:|:||
plant    74 RLRVELAHGGRGQSSSDRRGGYGGGGSGYGG--GGGGG----------GSARFGVSRHSEFRVIV 126

  Fly   125 ENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNE-GVVEFASLSDMKTAIEKLDDTELNGR---- 184
            ..|.|..|||||||:||:||:|.:|:..:..... |||::.:..|||.||.||||||....    
plant   127 RGLPSSASWQDLKDHMRKAGDVCFAEVTRDSDGTYGVVDYTNYDDMKYAIRKLDDTEFRNPWARG 191

  Fly   185 --RIHLVEDRRGGRSGGGGGSGRGRSRS-SSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRS 246
              |:...|            |.|.|||| |.||||||||.|||.|..|||||:|.||||| ..:.
plant   192 FIRVKKYE------------SSRSRSRSPSRSRSRSRSRSRSRGRGRSHSRSRSLSRSKS-PRKD 243

  Fly   247 KSKSPVKSRSRSRSRSNKSRDVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSKRESRSRSRS 308
            .||||.:|.|||.|   |||..|..|.||..|..|||..|   |||||||.||...:.|..|
plant   244 LSKSPRRSLSRSIS---KSRSPSPDKKKSPPRAMSRSKSR---SRSRSRSPSKSPPKVREGS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 33/72 (46%)
RRM2_SRSF4_like 120..191 CDD:241044 33/77 (43%)
SR34aNP_001190041.1 RRM_SF 9..79 CDD:418427 31/69 (45%)
RRM2_SF2_plant_like 122..197 CDD:410014 33/74 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.