DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and NUC-L2

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_188491.1 Gene:NUC-L2 / 821392 AraportID:AT3G18610 Length:636 Species:Arabidopsis thaliana


Alignment Length:278 Identity:86/278 - (30%)
Similarity:121/278 - (43%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GSR-VYVGGLPYGVRERDLERFFKGYGRTRDILIKN-------GYGFVEFEDYRDADDAVYELNG 59
            ||: ::.|.|.|.:...|:|.|||..|...|:.:.:       |||.:||....:|..|: |:||
plant   382 GSKTLFAGNLSYQIARSDIENFFKEAGEVVDVRLSSFDDGSFKGYGHIEFASPEEAQKAL-EMNG 445

  Fly    60 KELLGERVVVEPA--RGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRL 122
            |.|||..|.::.|  |||.|.||        .||:|.|          |:|        ||.|  
plant   446 KLLLGRDVRLDLANERGTPRNSN--------PGRKGEG----------SQS--------RTIY-- 482

  Fly   123 IVENLSSRVSWQDLKDYMR----QAGEVTYADAHKQRRNEGVVEFASLSDMKTAIE---KLDDTE 180
             |...||.:...::|..:|    :.||||.......|.......||.: |:.:..:   :|..:|
plant   483 -VRGFSSSLGEDEIKKELRSHFSKCGEVTRVHVPTDRETGASRGFAYI-DLTSGFDEALQLSGSE 545

  Fly   181 LNGRRIHLVEDRRGGRSGGGGGSGRGRSRSS-----SSRSRSRSRRRSRSRRSSHS-RSKSRSRS 239
            :.|..|| ||:.|...|..|..|.|..:|.:     |.|:....|...|:.|..|| |...|.|.
plant   546 IGGGNIH-VEESRPRDSDEGRSSNRAPARGAPRGRHSDRAPRGGRFSDRAPRGRHSDRGAPRGRF 609

  Fly   240 KSRGGRSKSKSPVKSRSR 257
            .:| ||..||..|...|:
plant   610 STR-GRGPSKPSVMESSK 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 26/78 (33%)
RRM2_SRSF4_like 120..191 CDD:241044 20/77 (26%)
NUC-L2NP_188491.1 RRM1_NUCLs 385..461 CDD:409884 26/76 (34%)
RRM2_NUCLs 480..556 CDD:409885 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.