DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and AT3G08000

DIOPT Version :10

Sequence 1:NP_788671.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_187457.1 Gene:AT3G08000 / 819991 AraportID:AT3G08000 Length:143 Species:Arabidopsis thaliana


Alignment Length:101 Identity:33/101 - (32%)
Similarity:49/101 - (48%) Gaps:24/101 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILI--------KNGYGFVEFEDYRDADDAVYELNGK 60
            |::::|||.:.|.|:.|:..|..:|...::.|        ..|:|||:|.:..||..|...::||
plant    41 SKLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDFAEEGDALSAKDAMDGK 105

  Fly    61 ELLG---------ERV----VVEPARGTARGSNRDR 83
            .|||         |||    ||.|..|.   |.|:|
plant   106 GLLGRPLRISFALERVRGGPVVVPRLGK---SKRER 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_788671.2 RRM1_SRSF4_like 5..74 CDD:409774 28/89 (31%)
RRM2_SRSF4_like 120..191 CDD:410012
AT3G08000NP_187457.1 RRM 42..124 CDD:440488 25/81 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.