DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and RS2Z33

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_850280.1 Gene:RS2Z33 / 818311 AraportID:AT2G37340 Length:290 Species:Arabidopsis thaliana


Alignment Length:360 Identity:113/360 - (31%)
Similarity:142/360 - (39%) Gaps:100/360 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVV 68
            :|:|||.|....|.|||||.|..|||.||:.:|..|.||||.|.||||||.:.|:|::..|.|:.
plant    11 TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFGDPRDADDARHYLDGRDFDGSRIT 75

  Fly    69 VEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSW 133
            ||.:||..||| || :|.|  |...|.|..:|                                 
plant    76 VEFSRGAPRGS-RD-FDSR--GPPPGAGRCFN--------------------------------- 103

  Fly   134 QDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRGGRSG 198
                     .|    .|.|..|.       .:..|.|....:.      |.|.|:..:.:.... 
plant   104 ---------CG----VDGHWARD-------CTAGDWKNKCYRC------GERGHIERNCKNSPK- 141

  Fly   199 GGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRS---RS 260
                    :.|.|.|.|||..|.||..||.|.|||.|||||.||     |:|||:.|.||   ||
plant   142 --------KLRRSGSYSRSPVRSRSPRRRRSPSRSLSRSRSYSR-----SRSPVRRRERSVEERS 193

  Fly   261 RSNKSRDVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSKRESRSRSRSKSIHRDSRSRDRSASAE 325
            ||.|..|.|.|     .|.|.|||  ..|.....:.:......|....|.:..|   ||..:..:
plant   194 RSPKRMDDSLS-----PRARDRSP--VLDDEGSPKIIDGSPPPSPKLQKEVGSD---RDGGSPQD 248

  Fly   326 NKSRS----------RSRSRSASPKNGNASPDRNN 350
            |...|          .|.....||.:.:..|:|.:
plant   249 NGRNSVVSPVVGAGGDSSKEDRSPVDDDYEPNRTS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 36/68 (53%)
RRM2_SRSF4_like 120..191 CDD:241044 9/70 (13%)
RS2Z33NP_850280.1 RRM_SF 12..81 CDD:418427 36/68 (53%)
PTZ00368 <86..144 CDD:173561 18/129 (14%)
MSCRAMM_ClfB <209..>289 CDD:411414 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 70 1.000 Domainoid score I3406
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.