DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and RSZ22a

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_180035.1 Gene:RSZ22a / 816995 AraportID:AT2G24590 Length:196 Species:Arabidopsis thaliana


Alignment Length:284 Identity:94/284 - (33%)
Similarity:114/284 - (40%) Gaps:103/284 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILIKN---GYGFVEFEDYRDADDAVYELNGKELLGE 65
            ||||||.|...|.||:||..|:.:|..|.:.:..   ||.|::|||.|||.||:.|::||.  |.
plant     2 SRVYVGNLDPRVTERELEDEFRSFGVIRSVWVARRPPGYAFLDFEDSRDARDAIREVDGKN--GW 64

  Fly    66 RVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSR 130
            ||.....||...|        |.|||.||.|||       .|..|                    
plant    65 RVEQSHNRGGGGG--------RGGGRGGGDGGR-------GRGGS-------------------- 94

  Fly   131 VSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRGG 195
                |||.|  :.||    ..|          ||                            |..
plant    95 ----DLKCY--ECGE----SGH----------FA----------------------------REC 111

  Fly   196 RSGGGGGSGRGRSRSSSSRSRSRSRRRSR----SRRSSHSRSKS----RSRSKSRGGRSKSKSPV 252
            ||.||.| ||.|||   |||||..|.|..    .|||...|::|    |.||.|..||:.|:||.
plant   112 RSRGGSG-GRRRSR---SRSRSPPRYRKSPTYGGRRSYSPRARSPPPPRRRSPSPRGRNYSRSPP 172

  Fly   253 KSRSRSR---SRSNKSRDVSKSKS 273
            ..|:|..   :..|..:||.:|:|
plant   173 PYRARDEVPYANGNGLKDVRRSRS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 31/71 (44%)
RRM2_SRSF4_like 120..191 CDD:241044 9/70 (13%)
RSZ22aNP_180035.1 RRM_SRSF3_like 3..71 CDD:240819 31/69 (45%)
zf-CCHC 97..111 CDD:278525 8/57 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.