DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and Cstf2

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_038955991.1 Gene:Cstf2 / 683927 RGDID:1596566 Length:624 Species:Rattus norvegicus


Alignment Length:185 Identity:44/185 - (23%)
Similarity:64/185 - (34%) Gaps:72/185 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRT--------RDILIKNGYGFVEFEDYRDADDAVYELNGKEL 62
            |:||.:||...|..|:..|...|..        |:.....||||.|::|...|..|:..|||:|.
  Rat    18 VFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREF 82

  Fly    63 LGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSS---------SRYG----- 113
            .|..:.|:.|.                          :||||....|         |.||     
  Rat    83 SGRALRVDNAA--------------------------SEKNKEELKSLGTGAPVIESPYGESISP 121

  Fly   114 --------------PP-----LRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYA 149
                          ||     |..:.:|.|:|     |.|:.::.:.|..::.||
  Rat   122 EDAPESISKAVASLPPEQMFELMKQMKLCVQN-----SPQEARNMLLQNPQLAYA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 25/75 (33%)
RRM2_SRSF4_like 120..191 CDD:241044 8/30 (27%)
Cstf2XP_038955991.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 25/101 (25%)
CSTF2_hinge 112..191 CDD:405077 14/65 (22%)
PRK14718 <444..>501 CDD:173181
CSTF_C 580..620 CDD:405061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.