DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and Spen

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006539132.1 Gene:Spen / 56381 MGIID:1891706 Length:3644 Species:Mus musculus


Alignment Length:401 Identity:107/401 - (26%)
Similarity:142/401 - (35%) Gaps:116/401 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRD--ILIKNG-----YGFVEFEDYRDADDAVYELNGKELL 63
            ::||.||..|||..:...||.|||...  ||.|.|     ..||:|.|.:.|..|...:|   .:
Mouse     8 LWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNSVN---KM 69

  Fly    64 GER----------VVVEPARG---TARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPP 115
            |:|          .:...|||   |...::|.|   ...|.||..||            ..||||
Mouse    70 GDRDLRTDYNEPGTIPSAARGLDETVSIASRSR---EVSGFRGSAGG------------PAYGPP 119

  Fly   116 L-------RTEYRL---------IVENLS-----------SRVSWQDLKDYMRQAGEVTYA---- 149
            .       |.|.||         ..|:.:           .|....| :||.|...|.|..    
Mouse   120 PSLHAREGRYERRLDGASDNRERAYEHSAYGHHERGTGAFDRTRHYD-QDYYRDPRERTLQHGLY 183

  Fly   150 -----------DAHKQRRNEGVVE-FASLSDMKTAIEKLDDT-ELNGRRIHLVEDRRGGRSGGGG 201
                       |||..|......| |...|.:...|.:.|.| |:.|||                
Mouse   184 YTSRSRSPNRFDAHDPRYEPRAREQFTLPSVVHRDIYRDDITREVRGRR---------------- 232

  Fly   202 GSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 266
                        ..||....||||..||.||::|..|..|:..| .::||..|.|||||.|:.|.
Mouse   233 ------------PERSYQHSRSRSPHSSQSRNQSPQRLASQASR-PTRSPSGSGSRSRSSSSDSI 284

  Fly   267 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSKRESRSRSRSKSIHRDSRSRDRSASAENKSRSR 331
            . |.|.|.|::.:...|.....||.:||...:...:.:.....|:.:|...:......:|..   
Mouse   285 S-SSSSSSSNTDSSDSSSTASDDSPARSVQSAAVPAPTSQLLSSLEKDEPRKSFGIKVQNLP--- 345

  Fly   332 SRSRSASPKNG 342
            .||...|.|:|
Mouse   346 VRSTDTSLKDG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 26/84 (31%)
RRM2_SRSF4_like 120..191 CDD:241044 24/107 (22%)
SpenXP_006539132.1 RRM1_SHARP 7..81 CDD:240794 25/75 (33%)
U2AF_lg 128..596 CDD:273727 67/263 (25%)
RRM2_SHARP 338..411 CDD:240795 6/22 (27%)
RRM3_SHARP 438..511 CDD:240796
RRM4_SHARP 512..588 CDD:240797
PTZ00121 <635..1272 CDD:173412
PHA03247 <1629..2063 CDD:223021
PHA03247 <2122..2642 CDD:223021
Collagen_mid <2641..>2722 CDD:374271
PHA03247 <2949..3474 CDD:223021
SPOC 3483..3642 CDD:369497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.