DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment B52 and hnrnpm

DIOPT Version :9

Sequence 1:	NP_001014619.2	Gene:	B52 / 41670	FlyBaseID:	FBgn0004587	Length:	355	Species:	Drosophila melanogaster
Sequence 2:	XP_005170511.1	Gene:	hnrnpm / 555643	ZFINID:	ZDB-GENE-030131-6898	Length:	715	Species:	Danio rerio

Alignment Length:	141	Identity:	51/141 - (36%)
Similarity:	66/141 - (46%)	Gaps:	29/141 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    79 SNRDRYDDRYGGRRGGGGGRYNE-KNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQDLKDYMRQ 142
            ||.:...:|...|  |||||:.. .|.|.|            |.:.|.|:...|.||.|||.|::
Zfish    20 SNHESRKERPPKR--GGGGRFEPYSNPNKR------------YSVFVSNIPYDVKWQTLKDLMKE 70

  Fly   143 -AGEVTYA----DAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRG-------- 194
             .|||||.    |...:.|...||||.:...||.|:||::...:|||.:.:.||..|
Zfish    71 KVGEVTYVEHLMDGEGKSRGCAVVEFRTEELMKKAVEKVNKHVMNGRPLKVKEDPDGVISQREAN 135

  Fly   195 -GRSGGGGGSG 204
             |..|||||.|
Zfish   136 RGHGGGGGGGG 146

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
B52	NP_001014619.2	RRM1_SRSF4_like	5..74	CDD:240783
B52	NP_001014619.2	RRM2_SRSF4_like	120..191	CDD:241044	29/75 (39%)
hnrnpm	XP_005170511.1	RRM	<19..>122	CDD:223796	41/115 (36%)
		HnRNP_M	20..47	CDD:288396	11/28 (39%)
		RRM1_hnRNPM	49..124	CDD:241101	28/74 (38%)
		RRM	<215..>309	CDD:223796
		RRM2_hnRNPM	233..308	CDD:241103
		RRM3_hnRNPM	639..715	CDD:241105
		RRM	<640..>715	CDD:223796
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0724
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900