DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and Nono

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_030107241.1 Gene:Nono / 53610 MGIID:1855692 Length:482 Species:Mus musculus


Alignment Length:181 Identity:40/181 - (22%)
Similarity:71/181 - (39%) Gaps:50/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILI--KNGYGFVEFEDYRDADDAVYELNGKELLGER 66
            ||::||.||..:.|.::.:.|:.||:..::.|  ..|:||:..|....|:.|..||:...|.|::
Mouse    76 SRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQ 140

  Fly    67 VVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRV 131
            :.|..|..:|                                            .|.|.||...|
Mouse   141 LRVRFACHSA--------------------------------------------SLTVRNLPQYV 161

  Fly   132 SWQDLKDYMRQAGEVTYA----DAHKQRRNEGVVEFASLSDMKTAIEKLDD 178
            |.:.|::.....|:|..|    |...:...:|:|||:.....:.|:::..:
Mouse   162 SNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 22/70 (31%)
RRM2_SRSF4_like 120..191 CDD:241044 16/63 (25%)
NonoXP_030107241.1 RRM1_p54nrb 75..145 CDD:241032 22/68 (32%)
RRM_SF 151..230 CDD:388407 16/62 (26%)
NOPS_p54nrb_PSF_PSPC1 221..313 CDD:240581
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.