DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and SF2

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster


Alignment Length:267 Identity:117/267 - (43%)
Similarity:146/267 - (54%) Gaps:55/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYG----FVEFEDYRDADDAVYELNGKELLGE 65
            |:|||.||..:|.:|::..|..:|:...:.:||..|    ||||||.|||||||...:|.:..|.
  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGY 72

  Fly    66 RVVVEPAR----GTARGSNRDRYDDRYGGRRGGG--GGRYNEKNKNSRSSSRYGPPL-RTEYRLI 123
            |:.||..|    |:.||.||   :||  .|.|||  |||              |||. |::||::
  Fly    73 RLRVEFPRGGGPGSYRGGNR---NDR--SRDGGGRMGGR--------------GPPAKRSQYRVM 118

  Fly   124 VENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRR--- 185
            |..|.:..|||||||:||:||:|.:||.:|.  ..|||||....|||.||:||||:......   
  Fly   119 VTGLPASGSWQDLKDHMREAGDVCFADTYKD--GSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEV 181

  Fly   186 --IHLVEDR--------RGGRSGGGGGSGRGRSRSSSSRSRSRS-----RRR-----SRSRRSSH 230
              |.:.||.        .||..|||||||.|.||....||||||     |||     |..||.|:
  Fly   182 AYIRVREDSGDNDRGGGGGGSGGGGGGSGGGGSRDYRDRSRSRSFSSRPRRRGTPTYSPVRRQSY 246

  Fly   231 SRSKSRS 237
            |||:|||
  Fly   247 SRSRSRS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 32/76 (42%)
RRM2_SRSF4_like 120..191 CDD:241044 34/75 (45%)
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 31/71 (44%)
RRM2_SRSF1_like 115..188 CDD:410013 34/74 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452129
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 1 1.000 - - otm68796
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.