DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and MYEF2

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_057216.3 Gene:MYEF2 / 50804 HGNCID:17940 Length:600 Species:Homo sapiens


Alignment Length:150 Identity:47/150 - (31%)
Similarity:72/150 - (48%) Gaps:24/150 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQDLKDY 139
            :|:....|..:...|.::......|: |:|||.:..:.||   ...|:.:.|:...:.||.:||.
Human    59 SAKEEKSDLKEKSTGSKKANRFHPYS-KDKNSGAGEKKGP---NRNRVFISNIPYDMKWQAIKDL 119

  Fly   140 MRQ-AGEVTYA----DAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED-------- 191
            ||: .|||||.    ||..:.|..|||||.....:|.|:|.::..:|:||.:::.||        
Human   120 MREKVGEVTYVELFKDAEGKSRGCGVVEFKDEEFVKKALETMNKYDLSGRPLNIKEDPDGENARR 184

  Fly   192 ---RRGGRSGGGG----GSG 204
               |.||...||.    |||
Human   185 ALQRTGGSFPGGHVPDMGSG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783
RRM2_SRSF4_like 120..191 CDD:241044 27/75 (36%)
MYEF2NP_057216.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..101 10/45 (22%)
RRM1_MYEF2 101..176 CDD:241102 27/74 (36%)
RRM 124..>596 CDD:330708 28/80 (35%)
RRM2_hnRNPM_like 235..308 CDD:240832
RRM3_MYEF2 524..600 CDD:241106
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.