DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and srsf5

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001004783.1 Gene:srsf5 / 448003 XenbaseID:XB-GENE-487049 Length:272 Species:Xenopus tropicalis


Alignment Length:324 Identity:176/324 - (54%)
Similarity:209/324 - (64%) Gaps:59/324 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGSRVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGE 65
            |.|.||::|.|....||:|:|||||||||.|||.:|.|:|||||:|.||||||||||:||||..|
 Frog     1 MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFDDPRDADDAVYELDGKELCNE 65

  Fly    66 RVVVEPA----RGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVEN 126
            ||.:|.|    ||..||..|.||:||:..||..|              .|..||:|||.||||||
 Frog    66 RVTIEHARLRSRGGPRGLGRGRYNDRFSSRRPRG--------------DRSAPPIRTENRLIVEN 116

  Fly   127 LSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED 191
            ||||||||||||:||||||||:||||:.:.|||||||||.||:|.|||||...|:|||:|.|:| 
 Frog   117 LSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYSDLKNAIEKLSGKEINGRKIKLIE- 180

  Fly   192 RRGGRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRS 256
                          |..|    .||||||.|||||.||.|||:|||||:            ||.|
 Frog   181 --------------GNKR----HSRSRSRSRSRSRSSSRSRSRSRSRSR------------KSYS 215

  Fly   257 RSRSRSNKSRDVSKSKSKSHSRTRSRSPKRERDSRSRSR---SVSKRESRSRSRSKSIHRDSRS 317
            ||||||...|   .::|||.|.:||..|::.:.|||.|:   ||.:::|||||||    .|||:
 Frog   216 RSRSRSRTPR---SNRSKSRSVSRSPVPEKSQKSRSPSKSPASVDRQKSRSRSRS----ADSRN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 46/72 (64%)
RRM2_SRSF4_like 120..191 CDD:241044 53/70 (76%)
srsf5NP_001004783.1 RRM1_SRSF4_like 5..73 CDD:240783 45/67 (67%)
RRM2_SRSF4_like 110..180 CDD:241044 53/69 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 1 1.000 - - X517
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.