DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and snrnp70

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001003875.1 Gene:snrnp70 / 445398 ZFINID:ZDB-GENE-040825-2 Length:495 Species:Danio rerio


Alignment Length:411 Identity:104/411 - (25%)
Similarity:149/411 - (36%) Gaps:115/411 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILI--------KNGYGFVEFEDYRDADDAVYELNGKEL 62
            ::|..:.|...|..|.|.|:.||..:.|.|        ..||.|:|:|..||...|....:||::
Zfish   105 LFVARINYDTTESKLRREFEVYGPIKRIYIVYNKKTGKPRGYAFIEYEHERDMHSAYKHADGKKI 169

  Fly    63 LGERVVVEPARGTARGSNRDRYDDRYGGRRGG---GGGRYNEKNKNSRSSSRYGP-PLRTEYRLI 123
            .|.||:|:..||......|.|   |.||..||   ||...|.|:.....:|||.. |:.::..  
Zfish   170 DGRRVLVDVERGRTVKGW
RPR---RLGGGLGGTRRGGADVNIKHSGRDDTSRYDDRPIGSDRD-- 229

  Fly   124 VENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHL 188
             .:...|......:|..::.||...:.:.::||:                          .|.|.
Zfish   230 -RDRGERRERSRERDRDKERGERRRSRSRERRRH--------------------------TRSHE 267

  Fly   189 VEDRRGGRSGGG-----------GGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSR 242
            .|....|...||           ||:|.|.||   .|||.|.|.|.|.||   |||:.|.|.:.|
Zfish   268 RERAAAGDEAGGSSRRRERERERGGAGAGESR---ERSRDRDRDRDRKRR---SRSRDRKRDRER 326

  Fly   243 G----------------------------------GRSKSKSPVKSRSRSRSRSNKSRDVSKSKS 273
            |                                  ||.:...| :...|.|.| :|.|:..:.:.
Zfish   327 GKGAEGGEEGMGGLVDGMMPEGGDRGIEDPLGGEPGRGEEGGP-EGEERGRDR-DKDRERDRDRK 389

  Fly   274 KSHSRTRSRSPKRERDSRSRSRSVSKRESRSRSRSKSIHRDSRSRDRSASAENKSRSRSRSRSAS 338
            :||   |.:..:|:||.|           |.|.|.:...||...|||....|::..:.|......
Zfish   390 RSH---RDKDRERDRDRR-----------RDRDRDRDHKRDRGDRDRGERREDRHITSSGDHEGL 440

  Fly   339 PKNGNAS----PDRNNESMDD 355
            ...|...    |.::.|...|
Zfish   441 GNGGEEGEEPVPPQSEEGSQD 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 24/75 (32%)
RRM2_SRSF4_like 120..191 CDD:241044 8/70 (11%)
snrnp70NP_001003875.1 U1snRNP70_N 2..>57 CDD:289024
RRM <98..>182 CDD:223796 25/76 (33%)
RRM_snRNP70 102..187 CDD:240682 26/81 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.