DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and trv

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:106 Identity:28/106 - (26%)
Similarity:47/106 - (44%) Gaps:13/106 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 YGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAH 152
            :..|..|||    :..::|.....|.|||..::.:.|.:|||.:..|.|::.....||:  :|..
  Fly   284 HAARTEGGG----QDMEDSDEEMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEI--SDCR 342

  Fly   153 KQR-------RNEGVVEFASLSDMKTAIEKLDDTELNGRRI 186
            ..|       :..|.|.|...|:.::||..::...|..|.|
  Fly   343 VVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783
RRM2_SRSF4_like 120..191 CDD:241044 19/74 (26%)
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 19/73 (26%)
RRM3_TIA1_like 416..491 CDD:240800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.