DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and CG5213

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:252 Identity:63/252 - (25%)
Similarity:98/252 - (38%) Gaps:75/252 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LPYGVRERDLERFFKGYGRTRDILI----KNG----YGFVEFEDYRDADDAVYELNGKELLGERV 67
            ||..:.|.:|.|.|..:|..|...|    :.|    ||||::...|.|..||..::|.|..|:|:
  Fly    48 LPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETRGKRL 112

  Fly    68 VVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVS 132
            .|..||.:       .|:                    |.|||.|           |.||.:.:.
  Fly   113 KVAFA
RPS-------EYE--------------------STSSSLY-----------VGNLPTYMD 139

  Fly   133 WQDLKDYMRQAGEVTYAD--AHK-QRRNEGV--VEFASLSDMKTAIEKLDDTELNGR----RIHL 188
            .:.:::.....|.:...:  .|| ..|:.||  ::|..:.|.:.|...:|...:.|.    .:..
  Fly   140 EKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKF 204

  Fly   189 VEDRRGGRSGGGGGSGRGRSRSSSSRSRSRSRRRS-------RSRRSSHSRSKSRSR 238
            ||..:.|            |.|:||.|:.:.:|:|       |.|.:.|..|| |||
  Fly   205 VEREKKG------------SSSTSSGSQYKDKRKSSPPPYKRRERTNDHHVSK-RSR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 24/70 (34%)
RRM2_SRSF4_like 120..191 CDD:241044 15/79 (19%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 23/68 (34%)
RRM 128..202 CDD:214636 16/84 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.