DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and Rbp1

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster


Alignment Length:138 Identity:45/138 - (32%)
Similarity:65/138 - (47%) Gaps:23/138 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKN---GYGFVEFEDYRDADDAVYELNGKELLGER 66
            :||||.|.....:.::|..|..||..|::.:..   |:.||||||.|||:||...|:|....|.|
  Fly    12 KVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGTRCCGTR 76

  Fly    67 VVVEPARGTARGSNRDRYDDRYGGRRG-GGGGRY----NEKNKNSRSSSRYGPPLRTEYRLIVEN 126
            :.||.:.|.:|...|..     ||..| .|.|||    :.:..::.:||.|.          :.|
  Fly    77 IRVEMSSGRSRDRRRGE-----GGSSGRSGSGRYRITPSARTTSTATSSFYN----------INN 126

  Fly   127 LSSRVSWQ 134
            |..:.|.|
  Fly   127 LQQQPSSQ 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 28/71 (39%)
RRM2_SRSF4_like 120..191 CDD:241044 4/15 (27%)
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 27/68 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.