DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and srsf1a

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_005157471.1 Gene:srsf1a / 406288 ZFINID:ZDB-GENE-040426-1950 Length:257 Species:Danio rerio


Alignment Length:265 Identity:122/265 - (46%)
Similarity:147/265 - (55%) Gaps:32/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYG-----FVEFEDYRDADDAVYELNGKELLG 64
            |:|||.||..:|.:|:|..|..||..|||.:||..|     ||||||.|||:||||..:|.:..|
Zfish    16 RIYVGNLPPDIRTKDVEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYARDGYDYDG 80

  Fly    65 ERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPP-LRTEYRLIVENLS 128
            .|:.||..| :.||..|..:....||..|||||      .......||||| .|:|||:||..|.
Zfish    81 YRLRVEFPR-SGRGMGRGGFGGGGGGGGGGGGG------GGGAPRGRYGPPSRRSEYRVIVSGLP 138

  Fly   129 SRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTEL---NGRRIHLVE 190
            ...|||||||:||:||:|.|||..  |...|||||....||..|:.|||:|:.   .|...::..
Zfish   139 PSGSWQDLKDHMREAGDVCYADVF--RDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRV 201

  Fly   191 DRRGGRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSR 255
            ...|.||            .|..|||||||.|||||..|::||:|.|..:|||  |...||..||
Zfish   202 KVDGPRS------------PSYGRSRSRSRSRSRSRSRSNNRSRSYSPRRSRG--SPQYSPRHSR 252

  Fly   256 SRSRS 260
            |||||
Zfish   253 SRSRS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 36/73 (49%)
RRM2_SRSF4_like 120..191 CDD:241044 34/73 (47%)
srsf1aXP_005157471.1 RRM <7..>87 CDD:223796 35/70 (50%)
RRM1_SRSF1 16..89 CDD:241041 36/72 (50%)
RRM <123..>189 CDD:223796 37/67 (55%)
RRM2_SRSF1_like 130..202 CDD:241045 34/73 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.