DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and rbm4.3

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_005172323.1 Gene:rbm4.3 / 406277 ZFINID:ZDB-GENE-040426-1938 Length:362 Species:Danio rerio


Alignment Length:381 Identity:74/381 - (19%)
Similarity:109/381 - (28%) Gaps:139/381 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVV 69
            ::::|.||......:|:..|..||...:..|...:.||..:|.:.|..|:..|:..:|.|..:.|
Zfish    24 KIFIGNLPQQAEVDELKSLFSQYGTVTECAIIKNFAFVHMDDRKSATKAIKNLHLYKLHGTPINV 88

  Fly    70 EPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQ 134
            |.:||                           ||:        ||     .:|.|.|:..... .
Zfish    89 EASRG---------------------------KNQ--------GP-----VKLHVANVEKGTD-D 112

  Fly   135 DLKDYMRQAGEV-------TYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDR 192
            :|:......|.|       .:|..|....:|.:          .||:.||:||..|:|||:    
Zfish   113 ELRALFEDYGTVAECAIIKNFAFVHMNNSDEAM----------DAIKGLDNTEFQGKRIHV---- 163

  Fly   193 RGGRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSR--------RSSHSRSKSRSRSKSRGGRSKSK 249
                              ..|:||.|........        |....|.:.....:.|.|.....
Zfish   164 ------------------QISKSRPRGEEDDYGHPDAGYWPPRYPGERPEPPGYPRGRYGYPPGP 210

  Fly   250 SPVKSRSRSRSRSNKSRDVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSKRESRSRSRSKSIHRD 314
            .|.......|                    ||..|.|...:..|.|.|.....:.|:|...:..|
Zfish   211 PPPPPPPPPR--------------------RSPYPDRAAPAYERQRDVVDYYEKYRARPYGVAYD 255

  Fly   315 SR----------------SRDRSAS---------------AENKSRSRSRSRSASP 339
            .|                .|||...               |...:|.||..|.|.|
Zfish   256 DRRPGGIPPPPPPPSSAIMRDRMPGNGLDPYERRPLPPPPASFYARDRSPIRRAPP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 18/68 (26%)
RRM2_SRSF4_like 120..191 CDD:241044 19/77 (25%)
rbm4.3XP_005172323.1 RRM_SF 23..89 CDD:302621 16/64 (25%)
RRM_SF 100..164 CDD:302621 19/96 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.