DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and srsf9

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001299828.1 Gene:srsf9 / 405835 ZFINID:ZDB-GENE-040426-2397 Length:245 Species:Danio rerio


Alignment Length:267 Identity:106/267 - (39%)
Similarity:141/267 - (52%) Gaps:40/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGSRVYVGGLPYGVRERDLERFFKGYGRTRDILIKNG-----YGFVEFEDYRDADDAVYELNGK 60
            |...|:|||.||..|:|||:|..|..||:.|||.:||.     :.||.|||.|||:|||:..||.
Zfish     1 MSDGRIYVGNLPMDVQERDIEDLFFKYGKIRDIELKNNRSTIPFAFVRFEDPRDAEDAVFGRNGY 65

  Fly    61 ELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPL-RTEYRLIV 124
            .....::.||..|.:  ||       ::.|..|||||        .....|:|||. |:|:|:||
Zfish    66 GFGDCKLRVEYPRSS--GS-------KFSGPAGGGGG--------GGPRGRFGPPTRRSEFRVIV 113

  Fly   125 ENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRR---- 185
            ..|....|||||||:||:||:|.:||.  ||..||||||....||:.|:.:||.||....:    
Zfish   114 TGLPPTGSWQDLKDHMREAGDVCFADV--QRDGEGVVEFLRREDMEYALRRLDSTEFRSHQGETA 176

  Fly   186 -IHLVEDRRGGRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSK 249
             |.::|:|         |:..|||| |.||||.|.....:||.|...|.:|..|..:|......:
Zfish   177 YIRVMEER---------GTSWGRSR-SRSRSRGRYTPPYQSRGSPPPRYRSPPRHMTRHSPPSRR 231

  Fly   250 SPVKSRS 256
            .|::..|
Zfish   232 PPLQHHS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 34/73 (47%)
RRM2_SRSF4_like 120..191 CDD:241044 34/75 (45%)
srsf9NP_001299828.1 RRM <1..>76 CDD:223796 34/74 (46%)
RRM1_SRSF9 5..76 CDD:241042 33/70 (47%)
RRM_SF 109..184 CDD:302621 35/76 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.