DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and rbm14b

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_021333123.1 Gene:rbm14b / 402858 ZFINID:ZDB-GENE-040426-2455 Length:560 Species:Danio rerio


Alignment Length:180 Identity:44/180 - (24%)
Similarity:69/180 - (38%) Gaps:43/180 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVV 69
            :::||.|.....:.:|...|:.||:.....:...:.||..:....|:.|:.||||:|..|..:||
Zfish     8 KLFVGNLALDTTQEELSAIFESYGQVVSCSVLRQFAFVHLQGEGAAERAIRELNGREFKGRNLVV 72

  Fly    70 EPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQ 134
            |.:||.                                       ||.:. ::.|.||||..:.:
Zfish    73 EESRGR---------------------------------------PLHST-KVFVGNLSSMCTTE 97

  Fly   135 DLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGR 184
            ||::..:..|:|...|..|   ....|...:..|...|||.|..|...||
Zfish    98 DLQELFQTFGKVLECDKVK---GYAFVHMENKEDALQAIEALHGTSFKGR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 20/68 (29%)
RRM2_SRSF4_like 120..191 CDD:241044 20/65 (31%)
rbm14bXP_021333123.1 RRM1_CoAA 7..75 CDD:241052 20/66 (30%)
RRM1_2_CoAA_like 84..149 CDD:240789 20/64 (31%)
AIR1 <150..>187 CDD:331526
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.