DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and tia1

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_012814227.2 Gene:tia1 / 394890 XenbaseID:XB-GENE-1002876 Length:389 Species:Xenopus tropicalis


Alignment Length:194 Identity:48/194 - (24%)
Similarity:83/194 - (42%) Gaps:38/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTR------DILIKNGYGFVEFEDYRDADDAVYELNGKELLG 64
            :|||.|...|.|..:.:.|...|..:      |....:.|.||||.::|.|..::..:||::::|
 Frog     9 LYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMG 73

  Fly    65 ERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTE--YRLIVENL 127
            :.|.|..|  |...|.:                      |::.|||... .||::  :.:.|.:|
 Frog    74 KEVKVNWA
--TTPSSQK----------------------KDANSSSVVS-TLRSQDHFHVFVGDL 113

  Fly   128 SSRVSWQDLKDYMRQAGEVTYADAHK-----QRRNEGVVEFASLSDMKTAIEKLDDTELNGRRI 186
            |..::..|:|......|.::.|...|     :.:..|.|.|.:..|.:.||.::....|.||:|
 Frog   114 SPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 22/73 (30%)
RRM2_SRSF4_like 120..191 CDD:241044 18/72 (25%)
tia1XP_012814227.2 RRM1_TIA1 8..81 CDD:410027 21/71 (30%)
RRM2_TIA1 104..181 CDD:410030 18/74 (24%)
RRM3_TIAR 214..286 CDD:241064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.