DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and srsf1b

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_956887.2 Gene:srsf1b / 393565 ZFINID:ZDB-GENE-040426-1467 Length:245 Species:Danio rerio


Alignment Length:266 Identity:122/266 - (45%)
Similarity:145/266 - (54%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYG-----FVEFEDYRDADDAVYELNGKELLG 64
            |:|||.||..:|.:|:|..|..||..|||.:||..|     ||||||.|||:||||..:|.:..|
Zfish    16 RIYVGNLPPDIRTKDVEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDG 80

  Fly    65 ERVVVE-PARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPP-LRTEYRLIVENL 127
            .|:.|| |..|            |.|||.|||||......      .||||| .|:|||:||..|
Zfish    81 YRLRVEFPRSG------------RGGGRGGGGGGGVGAPR------GRYGPPSRRSEYRVIVSGL 127

  Fly   128 SSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTEL---NGRRIHLV 189
            ....|||||||:||:||:|.|||..  |...|||||....||..|:.|||:|:.   .|...::.
Zfish   128 PPSGSWQDLKDHMREAGDVCYADVF--RDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIR 190

  Fly   190 EDRRGGRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKS 254
            ....|.||            .|..|||||||.|||||  |:|||:|.|..:|||  |...||..|
Zfish   191 VKVDGPRS------------PSYGRSRSRSRSRSRSR--SNSRSRSYSPRRSRG--SPRYSPRHS 239

  Fly   255 RSRSRS 260
            |||||:
Zfish   240 RSRSRT 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 37/74 (50%)
RRM2_SRSF4_like 120..191 CDD:241044 34/73 (47%)
srsf1bNP_956887.2 RRM <7..>87 CDD:223796 35/70 (50%)
RRM1_SRSF1 16..89 CDD:241041 36/72 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..116 15/44 (34%)
RRM2_SRSF1_like 120..192 CDD:241045 34/73 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..245 33/68 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.