DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and cstf2

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_009289373.1 Gene:cstf2 / 386806 ZFINID:ZDB-GENE-031118-2 Length:508 Species:Danio rerio


Alignment Length:185 Identity:44/185 - (23%)
Similarity:64/185 - (34%) Gaps:72/185 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYVGGLPYGVRERDLERFFKGYGRT--------RDILIKNGYGFVEFEDYRDADDAVYELNGKEL 62
            |:||.:||...|..|:..|...|..        |:.....||||.|::|...|..|:..|||:|.
Zfish    26 VFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREF 90

  Fly    63 LGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSS---------SRYG----- 113
            .|..:.|:.|.                          :||||....|         |.||     
Zfish    91 SGRALRVDNAA--------------------------SEKNKEELKSLGTGAPIIESPYGDGCMP 129

  Fly   114 --------------PP-----LRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYA 149
                          ||     |..:.:|.|:|     |.|:.::.:.|..::.||
Zfish   130 EEAPESISRAVASLPPEQMFELMKQMKLCVQN-----SPQEARNMLLQNPQLAYA 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 25/75 (33%)
RRM2_SRSF4_like 120..191 CDD:241044 8/30 (27%)
cstf2XP_009289373.1 RRM <24..>112 CDD:223796 29/111 (26%)
RRM_CSTF2_CSTF2T 26..100 CDD:241115 24/73 (33%)
CSTF2_hinge 121..199 CDD:291025 14/64 (22%)
CSTF_C 464..504 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.