DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and Srsf7

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001034124.2 Gene:Srsf7 / 362687 RGDID:1307425 Length:238 Species:Rattus norvegicus


Alignment Length:350 Identity:120/350 - (34%)
Similarity:146/350 - (41%) Gaps:129/350 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILIKN---GYGFVEFEDYRDADDAVYELNGKELLGE 65
            ::||||.|..|..:.:|||.|..||..|.:.|..   |:.||||||.|||:|||..|:||.:.|.
  Rat    11 TKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGS 75

  Fly    66 RVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSR 130
            ||.||.:.|..|.|..||                              ||.|..:          
  Rat    76 RVRVELSTGMPRRSRFDR------------------------------PPARRPF---------- 100

  Fly   131 VSWQDLKDYMRQAGEV-TYA-DAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRR 193
                |..|...:.||. .|| |.|:.                                       
  Rat   101 ----DPNDRCYECGEKGHYAYDCHRY--------------------------------------- 122

  Fly   194 GGRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRS 258
                          ||...|||||||..|||.||      .|||||:|||.||:|.||.:|||.|
  Rat   123 --------------SRRRRSRSRSRSHSRSRGRR------YSRSRSRSRGRRSRSASPRRSRSVS 167

  Fly   259 RSRSNKSRDVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSKRESRSRSRSKSIHRDSRSRDRSAS 323
                     :.:|:|.|..|:||.|....|..:||||      |||||||.|..|.|||:.||.|
  Rat   168 ---------LRRSRSASLRRSRSGSIIGSRYFQSRSR------SRSRSRSISRPRSSRSKSRSPS 217

  Fly   324 AENKSRSRSRSRSASPKNGNASPDR 348
            .:     ||||.|.|| :.:|||:|
  Rat   218 PK-----RSRSPSGSP-HRSASPER 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 35/71 (49%)
RRM2_SRSF4_like 120..191 CDD:241044 8/72 (11%)
Srsf7NP_001034124.2 RRM_SRSF7 12..88 CDD:410050 36/75 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.