DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and Srsf6

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001014207.2 Gene:Srsf6 / 362264 RGDID:1359241 Length:339 Species:Rattus norvegicus


Alignment Length:351 Identity:210/351 - (59%)
Similarity:244/351 - (69%) Gaps:37/351 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVV 69
            |||:|.|.|.|||:|::|||.||||..:|.:|||||||||||.|||||||||||.|||.||||:|
  Rat     3 RVYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNGYGFVEFEDSRDADDAVYELNSKELCGERVIV 67

  Fly    70 EPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQ 134
            |.|||..|  :||.|.  ||.|.||||  |:.:..:.|  .:||||:||||||||||||||.|||
  Rat    68 EHARGPRR--DRDGYS--YGSRSGGGG--YSSRRTSGR--DKYGPPVRTEYRLIVENLSSRCSWQ 124

  Fly   135 DLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRGGRSGG 199
            ||||:||||||||||||||:|.||||:||.|.||||.|::|||.||:|||.|.|:||:  .|:. 
  Rat   125 DLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDK--PRTS- 186

  Fly   200 GGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNK 264
                  .|...|.||||||||||||||....|||:|||.|||   ||:|:|..|.||||||:..|
  Rat   187 ------HRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKS---RSRSRSRSKGRSRSRSKGRK 242

  Fly   265 SRDVSKSKSK----SHSRTRSRSPKRERDSRSRSRSVSKRE-------SRSRSRSKSIHRD---- 314
            ||..||||.|    |||.:||||..:...|||||||.|.:|       |:|||||:|....    
  Rat   243 SRSKSKSKPKSDRGSHSHSRSRSKDKYGKSRSRSRSRSPKENGKGDIKSKSRSRSQSRSHSPLPA 307

  Fly   315 --SRSRDRSASAENKSRSRSRSRSAS 338
              |::|..|...:..|||||||||.|
  Rat   308 PPSKARSMSPPPKRASRSRSRSRSRS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 50/68 (74%)
RRM2_SRSF4_like 120..191 CDD:241044 55/70 (79%)
Srsf6NP_001014207.2 RRM_SF 1..72 CDD:418427 50/68 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..103 13/35 (37%)
RRM2_SRSF6 110..182 CDD:410159 56/71 (79%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..339 85/170 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I5979
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 350 1.000 Inparanoid score I2210
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 1 1.000 - - otm46259
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X517
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.