DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B52 and Srsf3

DIOPT Version :9

Sequence 1:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001041372.1 Gene:Srsf3 / 361814 RGDID:1309233 Length:164 Species:Rattus norvegicus


Alignment Length:287 Identity:77/287 - (26%)
Similarity:93/287 - (32%) Gaps:137/287 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKN---GYGFVEFEDYRDADDAVYELNGKELLGER 66
            :||||.|.....:.:|||.|..||..|.:.:..   |:.||||||.|||.|||.||:|:.|.|.|
  Rat    11 KVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCR 75

  Fly    67 VVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRV 131
            |.||.:.|..|..||                               |||               .
  Rat    76 VRVELSNGEKRSRNR-------------------------------GPP---------------P 94

  Fly   132 SWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRGGR 196
            ||                                                               
  Rat    95 SW--------------------------------------------------------------- 96

  Fly   197 SGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSR 261
                     ||......|.||...||...||.|.|||:|||.|:.|.         :.||.||.|
  Rat    97 ---------GRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRR---------RERSLSRER 143

  Fly   262 SNKSRDVSKSKSKSHSRTRSRSPKRER 288
            ::|       .|:|.||:||||...||
  Rat   144 NHK-------PSRSFSRSRSRSRSNER 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 34/71 (48%)
RRM2_SRSF4_like 120..191 CDD:241044 2/70 (3%)
Srsf3NP_001041372.1 RRM_SRSF3 6..86 CDD:241089 35/74 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.